PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G119100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 356aa    MW: 39593.1 Da    PI: 9.7332
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G119100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.96.4e-1566110348
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          W+ eE + l++ v+++G+++W+t+ar +  gR+++qc++rw  yl
  Sevir.1G119100.1.p  66 TWSREENDNLIQKVNLHGSKSWSTVARGIT-GRSPNQCRERWMFYL 110
                         7****************************9.***********9875 PP

2Myb_DNA-binding49.11.3e-15117157244
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                         ++W+++Ed +l++a+k +G++ W + a+ ++ gRt+k +k++w
  Sevir.1G119100.1.p 117 QPWSEQEDIKLIQAHKTHGNK-WCKLAKLFP-GRTGKAIKNHW 157
                         79*******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.07859110IPR017930Myb domain
SuperFamilySSF466898.07E-2762157IPR009057Homeodomain-like
SMARTSM007172.8E-1263112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-1866115IPR009057Homeodomain-like
CDDcd001671.20E-1166110No hitNo description
PfamPF139213.1E-1567127No hitNo description
PROSITE profilePS5129421.297111165IPR017930Myb domain
SMARTSM007175.4E-14115163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-21116166IPR009057Homeodomain-like
CDDcd001671.06E-12118157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MRRSGGGAAR QQSSGRSTSC SHEIDWIADE RGELRRPSKH FKDKEQKRTA EFLPHKAYNS  60
LKRRHTWSRE ENDNLIQKVN LHGSKSWSTV ARGITGRSPN QCRERWMFYL DPAVNNQPWS  120
EQEDIKLIQA HKTHGNKWCK LAKLFPGRTG KAIKNHWPSL VRKQMKSDLV KGLPKQFPLV  180
TKNKGSSTIK SGQDSSINIH VSPDMPVTPI LEQGLAKNGR NESTLKGKDY DSTHGEGYVS  240
HSVNVSEKVD GQIGRYNSSS SGDQKVSSAT ASFPGSPPKE ESTNLLEVTP NRGFSQAYNH  300
LSNNDRSDAI CSSADPESQE LHGSNIADLL DMSYCESLMI VPPDSPNHRN SMDGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-27671657105MYB PROTO-ONCOGENE PROTEIN
1msf_C2e-27671657105C-Myb DNA-Binding Domain
1mse_C2e-27671657105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952183.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLK3YUP00.0K3YUP0_SETIT; Uncharacterized protein
STRINGSi017986m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16796912
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.17e-36myb domain protein 3r-4